Skip to main content

Table 1 Sequences of synthesized peptides

From: Screening and identification of novel B cell epitopes of Toxoplasma gondii SAG1

Peptides Start and end position Sequence
PS1 1–30 aa MSVSLHHFIISSGFLASMFPKAVRRAVTAG
PS2 31–60 aa VFAAPTLMSFLRCGAMASDPPLVANQVVTC
PS3 61–90 aa PDKKSTAAVILTPTENHFTLKCPKTALTEP
PS4 91–120 aa PTLAYSPNRQICPAGTTSSCTSKAVTLSSL
PS5 121–150 aa IPEAEDSWWTGDSASLDTAGIKLTVPIEKF
PS6 151–180 aa PVTTQTFVVGCIKGDDAQSCMVTVTVQARA
PS7 181–210 aa SSVVNNVARCSYGANSTLGPVKLSAEGPTT
PS8 211–240 aa MTLVCGKDGVKVPQDNNQYCSGTTLTGCNE
PS9 241–270 aa KSFKDILPKLSENPWQGNASSDNGATLTIN
PS10 271–300 aa KEAFPAESKSVIIGCTGGSPEKHHCTVQLE
PS11 301–336 aa FAGAAGSAKSSAGTASHVSIFAMVTGLIGSIAACVA
PS4-1 91–105 aa PTLAYSPNRQICPAG
PS4-2 106–120 aa TTSSCTSKAVTLSSL
PS4-3 100–114 aa QICPAGTTSSCTSKA
PS6-1 151–165 aa PVTTQTFVVGCIKGD
PS6-2 159–173 aa VGCIKGDDAQSCMVT
PS6-3 166–180 aa DAQSCMVTVTVQARA
PS10-1 271–305 aa KEAFPAESKSVIIGC
PS10-2 281–294 aa VIIGCTGGSPEKHH
PS10-3 289–300 aa SPEKHHCTVQLE
PS11-1 301–315 aa FAGAAGSAKSSAGTA
PS11-2 313–332 aa GTASHVSIFAMVTGLIGSIA
PS11-3 306–320 aa GSAKSSAGTASHVSI