Skip to main content

Advertisement

Table 2 Differentially expressed proteins between T. gondii -infected and non-infected mouse brain tissues

From: Changes in the proteomic profiles of mouse brain after infection with cyst-forming Toxoplasma gondii

Spot No. Accession No. Protein name Score Expect Queries matched Sequence Coverage Nominal mass Calculated pI value Matched peptides Fold change (Infected/non-infected)A Functional categoriesB
Day 7, down-regulated proteins
1 IPI00230394 Lamin-B1 288 9.00E-25 27 36 66973 5.11 ASAPATPLSPTR;LQEKEELR;SLETENSALQLQVTEREEVR;ALYETELADARR;LREYEAALNSK;VDLENRCQSLTEDLEFRKNMYEEEINETRR;LVEVDSGR;LAQALHEMREQHDAQVRLYKEELEQTYHAK;LALDMEISAYR;LKNTSEQDQPMGGWEMIR;NQNSWGTGEDVK;NSQGEEVAQR;TTIPEEEEEEEEEPIGVAVEEERFHQQGAPR −2.91 Structural molecule activity
2 IPI00944143 Serpin B6 isoform a 218 9.00E-18 9 25 45201 5.99 SRPGCCAGPRGYR;NVFLSPMSISSALAMVFMGAK;TGTQYLLR;FYEAELEELDFQGATEESR;FIEWTR;LGMTDAFGGR;AFVEVNEEGTEAAAATAGMMTVR −1.68 Enzyme regulator activity and metabolic process
3 IPI00110721 Isoform 1 of Glyoxalase domain-containing protein 4 508 9.00E-47 12 41 33581 5.28 FQTVHFFRDVLGMQVLRHEEFEEGCK;LGNDFMGITLASSQAVSNAR;VAEGIFETEAPGGYKFYLQDR;IYEQDEEKQR;LELQGIQGAVDHAAAFGR;ELPDLEDLMKR;LLDDAMEADKSDEWFATR −1.51 Cell part and organelle
4 IPI00113660 Proteasome activator complex subunit 3 471 4.50E-43 9 42 29602 5.69 ITSEAEDLVANFFPK;RLDECEEAFQGTK;SNQQLVDIIEKVKPEIR;IEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITR;YPHVEDYRRTVTEIDEKEYISLR −1.70 Enzyme regulator activity
5 IPI00130344 Chloride intracellular channel protein 1 202 3.60E-16 6 39 27338 5.09 IGNCPFSQR;YPKLAALNPESNTSGLDIFAK;VLDNYLTSPLPEEVDETSAEDEGISQR;GFTIPEAFR;YLSNAYAREEFASTCPDDEEIELAYEQVAR −1.89 Transporter activity
6 IPI00121851 Prefoldin subunit 3 133 2.90E-09 4 15 22592 6 FLLADNLYCK;NLDSLEEDLDFLR;VYNWDVKR −1.51 Metabolic process
7 IPI00315794 Cytochrome b5 212 3.60E-17 6 54 16365 4.79 VEGSEPSVTYYR;NSAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAR;QYYIGDVHPSDLKPK −1.70 Binding and enzyme activator activity
8 IPI00124501 Galectin-related protein A 257 1.10E-21 8 57 19172 5.12 LDDGHLNNSLGSPVQADVYFPRLIVPFCGHIK;AVFTDR;NSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPR;VFVDGHQLFDFYHRIQTLSAIDTIK −1.74 Binding
9 IPI00308984 Eukaryotic translation initiation factor 1A 248 9.00E-21 3 28 16564 5.07 ELVFKEDGQEYAQVIK;LEAMCFDGVKR;VWINTSDIILVGLR −1.67 Binding
Day 7, up-regulated proteins
10 IPI00131830 Serine protease inhibitor A3K 470 5.70E-43 9 28 47021 5.05 DLQILAEFHEK;ALYQTEAFTADFQQPTEAK;ELISELDER;ISFDPQDTFESEFYLDEKR;HFRDEELSCSVLELK;MQQVEASLQPETLRK;FSIASNYR;AVLDVAETGTEAAAATGVIGGIR 2.55 Enzyme regulator activity
11 IPI00131830 Serine protease inhibitor A3K 511 4.50E-47 12 35 47021 5.05 DLQILAEFHEK;ALYQTEAFTADFQQPTEAK;ELISELDER;ISFDPQDTFESEFYLDEKR;HFRDEELSCSVLELK;MQQVEASLQPETLRK;FSIASNYRLEEDVLPEMGIKEVFTEQADLSGITETK;AVLDVAETGTEAAAATGVIGGIR 3.15 Enzyme regulator activity
12 IPI00131830 Serine protease inhibitor A3K 463 2.90E-42 10 28 47021 5.05 DLQILAEFHEK;ALYQTEAFTADFQQPTEAK;ELISELDER;ISFDPQDTFESEFYLDEKR;HFRDEELSCSVLELK;MQQVEASLQPETLRK;FSIASNYR;AVLDVAETGTEAAAATGVIGGIR 6.30 Enzyme regulator activity
13 IPI00131830 Serine protease inhibitor A3K 564 2.30E-52 14 35 47021 5.05 DLQILAEFHEK;ALYQTEAFTADFQQPTEAK;ELISELDER;ISFDPQDTFESEFYLDEKR;HFRDEELSCSVLELK;MQQVEASLQPETLRK;FSIASNYRLEEDVLPEMGIKEVFTEQADLSGITETKK;AVLDVAETGTEAAAATGVIGGIR 4.02 Enzyme regulator activity
14 IPI00131830 Serine protease inhibitor A3K 596 1.40E-55 12 35 47021 5.05 DLQILAEFHEK;ALYQTEAFTADFQQPTEAK;ELISELDER;ISFDPQDTFESEFYLDEKR;HFRDEELSCSVLELK;MQQVEASLQPETLRK;FSIASNYRLEEDVLPEMGIKEVFTEQADLSGITETK;AVLDVAETGTEAAAATGVIGGIR 5.80 Enzyme regulator activity
15 IPI00310972 GTP-GDP dissociation stimulator 1 isoform b 490 5.70E-45 18 27 61381 5.28 NEFMR;DQEVLLQTGR;EQFASTNIAEELVK;QIEHDKREMIFEVLAPLAENDAIK;LMDLLDRHVEDGNVTVQHAALSALR;SEMPPVQFK;MLIDAQAEAAEQLGK;LVEWCEAKDHAGVMGESNR;DLASAQLVQILHRLLADER;SVAQQASLTEQR 8.32 Cell part and organelle part
Day 14, down-regulated proteins
16 IPI00131871 COP9 signalosome complex subunit 4 449 7.20E-41 18 50 46541 5.57 QLLTDFCTHLPNLPDSTAK;VISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLK;LYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYK;KFIEAAQR;TIVHESERLEALKHALHCTILASAGQQR;MLATLFKDERCQQLAAYGILEK;ATTADGSSILDR;IASQMITEGRMNGFIDQIDGIVHFETR −2.50 Metabolic process
17 IPI00338039 Tubulin beta-2A chain 591 4.50E-55 22 42 50274 4.78 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNK;AILVDLEPGTMDSVR;GHYTEGAELVDSVLDVVRK;IREEYPDRIMNTFSVMPSPK;FPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPR;ISEQFTAMFRR −1.90 Structural molecule activity
18 IPI00113660 Proteasome activator complex subunit 3 450 5.70E-41 11 43 29602 5.69 ERITSEAEDLVANFFPK;RLDECEEAFQGTK;SNQQLVDIIEKVKPEIR;IEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITR;YPHVEDYRRTVTEIDEKEYISLR −2.04 Enzyme regulator activity
19 IPI00407019 Tetratricopeptide repeat protein 19 348 9.00E-31 12 23 41550 5.87 LSIMKDEPEAAELILHDALRLAYESDNRK;GQLENAEQLFK;QLSQAQR;ALQICQEIQGER;EIYQEALKR;RDEVSVQHIREELAELSR −1.99 Cell part, organelle and organelle part
20 IPI00133440 Prohibitin 688 9.00E-65 14 42 29859 5.57 AVIFDRFR;DLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILK;FDAGELITQR;QVSDDLTER;QVAQQEAER;AAELIANSLATAGDGLIELRKLEAAEDIAYQLSR −4.73 Metabolic process
21 IPI00313962 Ubiquitin carboxyl-terminal hydrolase isozyme L1 340 5.70E-30 8 39 25165 5.14 LGVAGQWR;QIEELKGQEVSPK;QFLSETEKLSPEDR;CFEKNEAIQAAHDSVAQEGQCR;MPFPVNHGASSEDSLLQDAAK;EFTEREQGEVR −1.68 Cell proliferation
22 IPI00322312 Rho GDP-dissociation inhibitor 1 536 1.40E-49 12 49 23450 5.12 SIQEIQELDKDDESLR;YKEALLGRVAVSADPNVPNVIVTR;EGVEYR;YIQHTYR;IDKTDYMVGSYGPRAEEYEFLTPMEEAPK;FTDDDKTDHLSWEWNLTIK −4.10 Enzyme regulator activity
23 IPI00845712 Isoform 1 of UPF0424 protein C1orf128 homolog 540 5.70E-50 17 73 24405 5.48 CAAEREEPPEQRGLAYGLYLR;LQCLNESR;GVFKPWEER;FVESDADEELLFNIPFTGNVKLKGVIIMGEDDDSHPSEMR;NIPQMSFDDTEREPEQTFSLNRDITGELEYATK;IFYIGLRGEWTELRRHEVTICNYEASANPADHRVHQVTPQTHFIS; −2.40 Cell part, organelle and organelle part
24 IPI00221826 Isoform Short of Splicing factor, arginine/serine-rich 3 226 1.40E-18 7 41 14422 10.12 DSCPLDCK;AFGYYGPLRSVWVARNPPGFAFVEFEDPR;NRGPPPSWGR;DDYRR −1000000 Metabolic process
Day 14, up-regulated proteins
25 IPI00123613 Protein kinase C and casein kinase substrate in neurons protein 1 382 3.60E-34 15 40 50886 5.15 LCNDLMSCVQER;AYAQQLTDWAKR;AWGAMMTEADKVSELHQEVK;AYHLACKEER;TTPQYMEGMEQVFEQCQQFEEKR;HLNLAENSSYMHVYRELEQAIRGADAQEDLR;KAEGATLSNATGAVESTSQAGDR;ALYDYDGQEQDELSFK;LGEEDEQGWCRGRLDSGQLGLYPANYVEAI 4.65 Catalytic activity and binding
26 IPI00110265 Isoform 1 of NAD-dependent deacetylase sirtuin-2 255 1.80E-21 11 35 43856 5.23 NLFTQTLGLGSQK;LLDELTLEGVTRYMQSER;VICLVGAGISTSAGIPDFR;HPEPFFALAK;CYTQNIDTLER;IFSEATPRCEQCQSVVKPDIVFFGENLPSR;APLATPR;ELEDLVRREHANIDAQSGSQAPNPSTTISPGK 1.57 Catalytic activity and binding
27 IPI00649438 Novel protein similar to splicing factor, arginine/serine-rich 3 80 0.00061 3 19 19404 11.41 NPPGFAFVEFEDPRDAADAVR;NRGLPPSWGR 1.65 Metabolic process
Day 21, down-regulated proteins
28 IPI00133522 Protein disulfide-isomerase 408 9.00E-37 17 37 57507 4.79 SNFEEALAAHK;ALAPEYAKR;LKAEGSEIR;VDATEESDLAQQYGVR;YQLDKDGVVLFKKFDEGRNNFEGEITK;HNQLPLVIEFTEQTAPK;ILFIFIDSDHTDNQR;KEECPAVR;YKPESDELTAEKITEFCHR;IKPHLMSQEVPEDWDKQPVKVLVGANFEEVAFDEKK;LGETYKDHENIIIAK;FFPASADR −1.52 Metabolic process
29 IPI00756786 SH3-domain GRB2-like endophilin B2 258 9.00E-22 11 26 45165 5.44 KLASDAGIFFTR;FGQAEKTELDAHFENLLAR;NWTER;QTEVLLQPNPSAR;ATCEGDTVPDFQETRPR;VAQTEFDRQAEVTRLLLEGISSTHVNHLR;SQTTYYAQCYR −1.50 Cellular process
30 IPI00111556 Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform 239 7.20E-20 10 34 36123 5.21 SPDTNYLFMGDYVDR;QITQVYGFYDECLRKYGNANVWK;LQEVPHEGPMCDLLWSDPDDRGGWGISPR;AHQLVMEGYNWCHDRNVVTIFSAPNYCYR;YSFLQFDPAPR −2.10 Metabolic process
31 IPI00798544 Isoform 2 of Enolase-phosphatase E1 384 2.30E-34 11 24 25457 4.92 QLQGHMWK;MKAEFFADVVPAVRRWREAGMKVYIYSSGSVEAQK;GHKVDSESYRK −3.54 Metabolic process
32 IPI00230145 Ferritin heavy chain 408 9.00E-37 11 65 21224 5.53 QNYHQDAEAAINR;YFLHQSHEEREHAEK;KPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVK;ELGDHVTNLRKMGAPEAGMAEYLFDKHTLGHGDES −1.56 Immune system process
Day 21, up-regulated proteins
33 IPI00403810 Tubulin alpha-1C chain 174 2.30E-13 5 16 50562 4.96 AVFVDLEPTVIDEVR;EIIDLVLDR;NLDIERPTYTNLNR;FDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK 1.56 Structural molecule activity
34 IPI00221540 Erlin-2 339 7.20E-30 8 17 38077 5.37 SVQTTLQTDEVK;VTKPNIPEAIRR;VAQVAEITYGQK;KISEIEDAAFLAR;AKADAECYTALK 1.85 Metabolic process
35 IPI00230192 Isoform Alpha-1 of Guanine nucleotide-binding protein G(o) subunit alpha 170 5.70E-13 5 16 40629 5.34 AMDTLGVEYGDKER;LWGDSGIQECFNR;YYLDSLDRIGAGDYQPTEQDILR;LFDVGGQR 1.54 Signal transducer activity
36 IPI00653664 Isoform 1 of Enolase-phosphatase E1 365 1.80E-32 11 27 28696 4.79 EYLQTHWEEEECQQDVSLLR;QLQGHMWK;MKAEFFADVVPAVRRWREAGMKVYIYSSGSVEAQK;VDSESYRK 1.96 Metabolic process
37 IPI00130280 ATP synthase subunit alpha 376 1.40E-33 11 18 59830 9.22 TGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIAR;NVQAEEMVEFSSGLK;TGAIVDVPVGEELLGR;APGIIPRISVREPMQTGIKAVDSLVPIGR;ELI IGDR 2.43 Transporter activity and developmental process
38 IPI00129161 Somatotropin 201 4.50E-16 14 45 24986 5.97 AQHLHQLAADTYKEFERAYIPEGQR;EEAQQRTDMELLR;IFTNSLMFGTSDR;LKDLEEGIQALMQELEDGSPR;QTYDKFDANMR;AETYLR;RFVESSCAF 19.73 Cell proliferation
Spots 39–46 were down-regulated on both day 14 and day 21
39 IPI00119113 V-type proton ATPase subunit B 641 4.50E-60 34 64 56857 5.57 MALRAMRGIVNGAAPELPVPTGGPMAGAR;NYLSQPR;YAEIVHLTLPDGTKR;AVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGR;GPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIAR;IPIFSAAGLPHNEIAAQICR;SKDVVDYSEENFAIVFAAMGVNMETAR;LALTTAEFLAYQCEKHVLVILTDMSSYAEALR;RGFPGYMYTDLATIYER;QIYPPINVLPSLSRLMKSAIGEGMTR;DHADVSNQLYACYAIGK;AVVGEEALTSDDLLYLEFLQK;NFITQGPYENRTVYETLDIGWQLLR;RIPQSTLSEFYPR −2.11 Transporter activity
40 IPI00759870 Isoform 4 of Heterogeneous nuclear ribonucleoproteins C1/C2 201 4.50E-16 3 9 32261 4.95 GFAFVQYVNER;MYSYPARVPPPPPIAR −1.52 Metabolic process
41 IPI00115117 Stomatin-like protein 2 231 4.50E-19 12 32 38475 8.95 NTVILFVPQQEAWVVER;ILEPGLNVLIPVLDR;ASYGVEDPEYAVTQLAQTTMR;YEIKDIHVPPRVKESMQMQVEAER;ATVLESEGTR;APVPGAQNSSQSRRDVQATDTSIEELGR −2.33 Organelle and organelle part
42 IPI00830393 Putative uncharacterized protein Cops6 209 7.20E-17 8 31 33855 5.65 SQEGRPMQVIGALIGK;NIEVMNSFELLSHTVEEK;QVCEIIESPLFLK;IGVDHVAR;LILEYVKASEAGEVPFNHEILR;TCNTMNQFVNKFNVLYDR −2.91 Cellular process and metabolic process
43 IPI00311515 Beta-soluble NSF attachment protein 415 1.80E-37 20 69 33878 5.32 EAVQLMAEAEKR;ASHSFLRGLFGGNTRIEEACEMYTR;NWSAAGNAFCQAAK;HDSATSFVDAGNAYK;HHITIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANK;VAAYAAQLEQYQKAIEIYEQVGANTMDNPLLK;AALCHFIVDELNAKLALEKYEEMFPAFTDSRLLEAHEEQNSEAYTEAVKEFDSISRLDQWLTTMLLR; −1.67 Cellular process
44 IPI00322312 Rho GDP-dissociation inhibitor 1 396 1.40E-35 9 42 23450 5.12 SIQEIQELDKDDESLR;YKEALLGRVAVSADPNVPNVIVTR;EGVEYR;YIQHTYR;IDKTDYMVGSYGPR;FTDDDKTDHLSWEWNLTIK −1000000 Enzyme regulator activity
45 IPI00133853 UPF0687 protein C20orf27 homolog 268 9.00E-23 8 50 19692 6.19 FAAGHDAEGSQSHVHFDEK;YEITFTLPPVR;ETPVHSLHLKLLSVTPTSEGYSIK;EGVLKEEMLLACEGDIGTCVR;HHGTPMLLDGVK −1.70 Cell part and organelle part
46 IPI00315504 ADP-ribosylation factor-like protein 2 75 0.0016 2 8 21022 5.67 ELQSLLVEER;SHHWR −1.66 Binding
Spots 47–56 were up-regulated on both day 14 and day 21
47 IPI00129526 Endoplasmin 766 1.40E-72 33 38 92703 4.74 TDDEVVQREEEAIQLDGLNASQIR;FAFQAEVNR;NKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVK;NLLHVTDTGVGMTREELVKEVEEDEYKAFYK;ESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKK;RVFITDDFHDMMPKYLNFVKGVVDSDDLPLNVSR;IADEKYNDTFWK;LGVIEDHSNR;FQSSHHSTDITSLDQYVER;QDKIYFMAGSSRKEAESSPFVEREATEKEFEPLLNWMK;LTESPCALVASQYGWSGNMER;DISTNYYASQKKTFEINPR;AYGDRIER 1.54 Metabolic process
48 IPI00123639 Calreticulin 292 3.60E-25 5 16 48136 4.33 EQFLDGDAWTNR;HEQNIDCGGGYVK;IDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDER;GEWKPR 1.66 Immune system process,
49 IPI00131830 Serine protease inhibitor A3K 175 1.80E-13 6 21 47021 5.05 ALYQTEAFTADFQQPTEAK;ISFDPQDTFESEFYLDEKR;HFRDEELSCSVLELK;MQQVEASLQPETLRK;AVLDVAETGTEAAAATGVIGGIR; 1000000 Enzyme regulator activity
50 IPI00131830 Serine protease inhibitor A3K 336 1.40E-29 9 27 47021 5.05 GKTMEEILEGLK;DLQILAEFHEK;ALYQTEAFTADFQQPTEAK;ISFDPQDTFESEFYLDEKR;HFRDEELSCSVLELK;MQQVEASLQPETLRK;AVLDVAETGTEAAAATGVIGGIR 12.57 Enzyme regulator activity
51 IPI00131830 Serine protease inhibitor A3K 316 1.40E-27 8 26 47021 5.05 DLQILAEFHEK;ALYQTEAFTADFQQPTEAK;ISFDPQDTFESEFYLDEKR;HFRDEELSCSVLELK;MQQVEASLQPETLRK;FSIASNYR;AVLDVAETGTEAAAATGVIGGIR 5.29 Enzyme regulator activity
52 IPI00131830 Serine protease inhibitor A3K 187 1.10E-14 5 16 47021 5.05 ISFDPQDTFESEFYLDEKR;HFRDEELSCSVLELK;MQQVEASLQPETLR;AVLDVAETGTEAAAATGVIGGIR 1000000 Enzyme regulator activity
53 IPI00131287 Isoform 1 of N-terminal EF-hand calcium-binding protein 2 374 2.30E-33 11 28 43870 5.18 APLVPDIPSADPGPGPAASRGGTAVILDIFR;KVYEGGSNVDQFVTR;YGGPTPPYIPNHK;TLSFDLQQRLSDEEGTNMHLQLVRQEMAVCPEQLSEFLDSLR;NCFHVAAVR 1000000 Cell part and binding
54 IPI00928020 Putative uncharacterized protein Otub1 331 4.50E-29 7 25 28190 5.15 IQQEIAVQNPLVSER;EYAEDDNIYQQK;YSYIRKTRPDGNCFYR;LLTSGYLQR;FFEHFIEGGR 1.89 Metabolic process
55 IPI00323571 Apolipoprotein E 329 7.20E-29 14 39 35901 5.56 FWDYLR;ELEEQLGPVAEETR;LGADMEDLR;NEVHTMLGQSTEEIR;LSTHLR;LGPLVEQGR;TANLGAGAAQPLR;AQAFGDR;GRLEEVGNQAR;SKMEEQTQQIRLQAEIFQAR;GWFEPIVEDMHR 1000000 Binding and antioxidant activity,
56 IPI00278230 NFU1 iron-sulfur cluster scaffold homolog 131 4.50E-09 5 17 28922 4.92 FIPGKPVLETRTMDFPTPAAAFR;IRPTVQEDGGDVIYRGFEDGIVR 1000000 Organelle and organelle part