Skip to content

Advertisement

Parasites & Vectors

What do you think about BMC? Take part in

Open Access

Screening and identification of novel B cell epitopes of Toxoplasma gondii SAG1

Parasites & Vectors20136:125

https://doi.org/10.1186/1756-3305-6-125

Received: 4 January 2013

Accepted: 26 April 2013

Published: 30 April 2013

Abstract

Background

The identification of protein epitopes is useful for diagnostic purposes and for the development of peptide vaccines. In this study, the epitopes of Toxoplasma gondii SAG1 were identified using synthetic peptide techniques with the aid of bioinformatics.

Findings

Eleven peptides derived from T. gondii SAG1 were assessed by ELISA using pig sera from different time points after infection. Four (PS4, PS6, PS10 and PS11), out of the eleven peptides tested were recognized by all sera. Then, shorter peptides that were derived from PS4, PS6, PS10 and PS11 were predicted using bioinformatics and tested by experimentation. Four out of nine shorter peptides were identified successfully (amino acids 106–120, 166–180, 289–300 and 313–332).

Conclusions

We have precisely located the epitopes of T. gondii SAG1 using pig sera collected at different time points after infection. The identified epitopes may be useful for the further study of epitope-based vaccines and diagnostic reagents.

Keywords

Toxoplasma gondii SAG1EpitopePig antibodies

Findings

Toxoplasma gondii is an obligate intracellular parasite that infects a variety of mammals and birds, causing toxoplasmosis [1, 2]. T. gondii is an important food-borne parasite, and the primary route of transmission from animals to humans is through the consumption of infected meat [3, 4]. In some countries, pork is the most common meat consumed, and some ethnic groups consume raw pork; thus, pigs are considered to be the primary source of human infection with T. gondii[5]. In addition, toxoplasmosis is a source of significant economic losses for swine farmers [6]. Therefore, the development of effective diagnostic reagents or vaccines for controlling this infection is required. Attempts to develop a peptide-based vaccine for T. gondii have focused on SAG1 and shown encouraging results [7]. Furthermore, the multiepitope antigen is one of the most promising antigens for the serodiagnosis of toxoplasmosis. Thus, it is very important to determine the precise sequences against which effective immune responses are directed. SAG1 epitopes have been studied by different research groups [810]. However, it is still unclear which SAG1 peptides are recognized by antibodies from pigs infected with T. gondii. Therefore, B cell epitopes of SAG1 were analyzed using a synthetic peptide technique in combination with software-based prediction.

Serum samples

A total of 51 T. gondii-positive sera, which had been previously collected from experimentally infected pigs by our lab, were investigated. Twelve pig serum samples were collected at the time of presentation of clinical symptoms (G1); 18 follow-up specimens were taken on days 14 to 35 after the onset of symptoms (G2), and 21 further serum samples were taken on days 60 to 120 after the onset of symptoms (G3). Toxoplasma IgM and IgG antibodies were confirmed by T. gondii lysate antigen-ELISA. The serum samples in G1 and G2 were positive for IgM and IgG against T. gondii. The serum samples in G3 were only positive for IgG against T. gondii. Ten sera that were negative for T. gondii IgM and IgG were used as controls. The experimental protocol was approved by the Ethical Committee of the Lanzhou Veterinary Research Institute, Chinese Academy of Agricultural Sciences.

Synthetic peptides

Based on the sequence of T. gondii SAG1 (Genbank Accession No. FJ455529), 20 non-overlapping or overlapping 12–36 mer peptides were synthesized by GL Biochem Ltd (Shanghai, China). Peptide sequences are shown in Table 1.
Table 1

Sequences of synthesized peptides

Peptides

Start and end position

Sequence

PS1

1–30 aa

MSVSLHHFIISSGFLASMFPKAVRRAVTAG

PS2

31–60 aa

VFAAPTLMSFLRCGAMASDPPLVANQVVTC

PS3

61–90 aa

PDKKSTAAVILTPTENHFTLKCPKTALTEP

PS4

91–120 aa

PTLAYSPNRQICPAGTTSSCTSKAVTLSSL

PS5

121–150 aa

IPEAEDSWWTGDSASLDTAGIKLTVPIEKF

PS6

151–180 aa

PVTTQTFVVGCIKGDDAQSCMVTVTVQARA

PS7

181–210 aa

SSVVNNVARCSYGANSTLGPVKLSAEGPTT

PS8

211–240 aa

MTLVCGKDGVKVPQDNNQYCSGTTLTGCNE

PS9

241–270 aa

KSFKDILPKLSENPWQGNASSDNGATLTIN

PS10

271–300 aa

KEAFPAESKSVIIGCTGGSPEKHHCTVQLE

PS11

301–336 aa

FAGAAGSAKSSAGTASHVSIFAMVTGLIGSIAACVA

PS4-1

91–105 aa

PTLAYSPNRQICPAG

PS4-2

106–120 aa

TTSSCTSKAVTLSSL

PS4-3

100–114 aa

QICPAGTTSSCTSKA

PS6-1

151–165 aa

PVTTQTFVVGCIKGD

PS6-2

159–173 aa

VGCIKGDDAQSCMVT

PS6-3

166–180 aa

DAQSCMVTVTVQARA

PS10-1

271–305 aa

KEAFPAESKSVIIGC

PS10-2

281–294 aa

VIIGCTGGSPEKHH

PS10-3

289–300 aa

SPEKHHCTVQLE

PS11-1

301–315 aa

FAGAAGSAKSSAGTA

PS11-2

313–332 aa

GTASHVSIFAMVTGLIGSIA

PS11-3

306–320 aa

GSAKSSAGTASHVSI

ELISA analysis

ELISA for each peptide were performed as described by Cardona et al. [10], except that microplates were coated with 10 μg/ml peptide and peroxidase-conjugated anti-pig IgG (1:4000) was used as the secondary antibody. PS1 was negative to all sera; PS2, PS3, PS5, PS7, PS8 and PS9 were recognized by few or partial sera (PS2: 5/51, PS3: 13/51, PS5: 24/51, PS7: 32/51, PS8: 6/51 and PS9: 25/51), and only Four peptides (PS4, PS6, PS10 and PS11) were recognized by all sera (Figure 1). For each of the 4 peptides, no significant differences were observed between the mean absorbances of the three groups, as determined by an ANOVA statistical test. The mean absorbance ± standard deviation of one peptide (amino acids 271–300) was significantly higher (0.337 ± 0.053) than that of the other peptides (PS4: 0.235 ± 0.025, p = 0.000; PS6: 0.237 ± 0.0028, p = 0.000; PS11: 0.266 ± 0.039, p = 0.001). Five peptides (amino acids 61–80, 181–200, 241–260 and 301–320) derived from SAG1 were determined to be B cell epitopes, and one peptide (amino acids 301–320) was the peptide that was most strongly recognized by sera from patients with human ocular toxoplasmosis [10]. A robust immunological response to the SAG1 is associated with chronic Toxoplasma infection in humans [11]. However, we found that peptides derived from SAG1 were capable of being recognized by pig sera from different time points after infection, which is different from previous reports. The discrepancy could be explained by differences in parasite strains, by using different animal models as well as by the different MHC-types between human and pig.
Figure 1

ELISA of IgG antibodies against different peptides in four groups of pig sera. (A), (B), (C) and (D) show the absorbances targeting to PS4, PS6, PS10 and PS11, respectively. The cut-off point for the assay is indicated by the horizontal line.

Precise definition of the epitopes

To further determine the epitopes of SAG1 and decrease the number of laboratory experiments, bioinformatics was used to predict the epitopes. The secondary structure and the surface properties of the SAG1 were analyzed as described by Zhang [12]. The results are shown in Figure 2. Based on these results, 9 shorter peptides that were derived from PS4, PS6, PS10 and PS11 were chosen for further investigation (Table 1). These peptides were tested using pig sera as described above. Four out of 9 peptides (PS4-2, PS6-3, PS10-3 and PS11-2) were recognized by all sera. The results are shown in Figure 3.
Figure 2

Secondary structures, flexibility, hydrophilicity, surface probability and antigenicity index for T. gongdii SAG1 .

Figure 3

ELISA of IgG antibodies against different peptides in four groups of pig sera. (A), (B), (C) and (D) show the absorbances targeting to PS4-2, PS6-3, PS10-3 and PS11-2, respectively. The cut-off point for the assay is indicated by the horizontal line.

Conclusion

Conformational epitope selection needs to determine the tertiary structure of antigen in order to identify antibody interacting residues in antigen. Experimental techniques such as crystallography are expensive and time consuming. Thus, our work focuses on linear epitope selection. In this study, we have located the epitopes of T. gondii SAG1 to a shorter sequence than had been identified previously. The identified epitopes will be useful in vaccine and diagnostic reagent design.

Declarations

Acknowledgments

This investigation was supported by grants from the National Special Research Programs for Non-profit Trades (Agriculture) (200903036–02) and NBCITS, MOA (CARS-38).

Authors’ Affiliations

(1)
State Key Laboratory of Veterinary Etiological Biology
(2)
Key Laboratory of Veterinary Public Health of the Ministry of Agriculture
(3)
Lanzhou Veterinary Research Institute, Chinese Academy of Agricultural Sciences

References

  1. Nardoni S, Angelici M, Mugnaini L, Mancianti F: Prevalence of Toxoplasma gondii infection in Myocastor coypus in a protected Italian wetland. Parasites Vectors. 2011, 4: 240-10.1186/1756-3305-4-240.PubMed CentralView ArticlePubMedGoogle Scholar
  2. Zhou P, Chen Z, Li HL, Zheng H, He S, Lin RQ, Zhu XQ: Toxoplasma gondii infection in humans in China. Parasit Vectors. 2011, 4: 165-10.1186/1756-3305-4-165.PubMed CentralView ArticlePubMedGoogle Scholar
  3. Boughattas S, Bergaoui R, Essid R, Aoun K, Bouratbine A: Seroprevalence of Toxoplasma gondii infection among horses in Tunisia. Parasites Vectors. 2011, 4: 218-10.1186/1756-3305-4-218.PubMed CentralView ArticlePubMedGoogle Scholar
  4. Yang N, Mu MY, Li HK, Long M, He JB: Seroprevalence of Toxoplasma gondii infection in slaughtered chickens, ducks, and geese in Shenyang, northeastern China. Parasites Vectors. 2012, 5: 237-10.1186/1756-3305-5-237.PubMed CentralView ArticlePubMedGoogle Scholar
  5. Wang M, Wang YH, Ye Q, Meng P, Yin H, Zhang DL: Serological survey of Toxoplasma gondii in Tibetan mastiffs (Canislupus familiaris) and yaks (Bos grunniens) in Qinghai, China. Parasites Vectors. 2012, 5: 35-10.1186/1756-3305-5-35.PubMed CentralView ArticlePubMedGoogle Scholar
  6. Sun XS, Zou J, Elashram Saeed AA, Yan WC, Liu XY, Suo X, Wang H, Chen QJ: DNA vaccination with a gene encoding Toxoplasma gondii GRA6 induces partial protection against toxoplasmosis in BALB/c mice. Parasites Vectors. 2011, 4: 213-10.1186/1756-3305-4-213.PubMed CentralView ArticlePubMedGoogle Scholar
  7. Wang YH, Wang M, Wang GX, Pang AN, Fu BQ, Yin H, Zhang DL: Increased survival time in mice vaccinated with a branched lysine multiple antigenic peptide containing B- and T-cell epitopes from T. gondii antigens. Vaccine. 2011, 29: 8619-8623. 10.1016/j.vaccine.2011.09.016.View ArticlePubMedGoogle Scholar
  8. Velge-Roussel F, Chardès T, Mévélec P, Brillard M, Hoebeke J, Bout D: Epitopic analysis of the Toxoplasma gondii major surface antigen SAG1. Mol Biochem Parasitol. 1994, 66: 31-38. 10.1016/0166-6851(94)90033-7.View ArticlePubMedGoogle Scholar
  9. Siachoque H, Guzman F, Burgos J, Patarroyo ME, Marin JEG: Toxoplasma gondii: Immunogenicity and protection by P30 peptides in a murine model. Exp Parasitol. 2006, 114: 62-65. 10.1016/j.exppara.2006.02.005.View ArticlePubMedGoogle Scholar
  10. Cardona N, de-la-Torre A, Siachoque H, Patarroyo MA, Gomez-Marin JE: Toxoplasma gondii: P30 peptides recognition pattern in human toxoplasmosis. Exp Parasitol. 2009, 123: 199-202. 10.1016/j.exppara.2009.06.017.View ArticlePubMedGoogle Scholar
  11. Jalallou N, Bandepour M, Khazan H, Haghighi A, Abdollahi SH, Kazemi B: Recombinant SAG1 antigen to detect Toxoplasma gondii specific immunoglobulin G in human sera by ELISA test. Iranian J Parasitol. 2010, 5: 1-9.Google Scholar
  12. Zhang ZW, Zhang YG, Wang YL, Pan L, Fang YZ, Jiang ST, Lu JL, Zhou P: Screening and identification of B cell epitopes of structural proteins of foot-and-mouth disease virus serotype Asia I. Vet Microbiol. 2010, 140: 25-33. 10.1016/j.vetmic.2009.07.011.View ArticlePubMedGoogle Scholar

Copyright

© Wang et al.; licensee BioMed Central Ltd. 2013

This article is published under license to BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

Comments

By submitting a comment you agree to abide by our Terms and Community Guidelines. If you find something abusive or that does not comply with our terms or guidelines please flag it as inappropriate.

Advertisement